General Information

  • ID:  hor001969
  • Uniprot ID:  P18509
  • Protein name:  Pituitary adenylate cyclase-activating polypeptide 27
  • Gene name:  ADCYAP1
  • Organism:  Homo sapiens (Human)
  • Family:  Glucagon family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with ADCYAP1 include Persian Gulf Syndrome and Sudden Infant Death Syndrome.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0016521 pituitary adenylate cyclase activating polypeptide activity; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007190 activation of adenylate cyclase activity; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0007267 cell-cell signaling; GO:0007399 nervous system development; GO:0007565 female pregnancy; GO:0008277 regulation of G protein-coupled receptor signaling pathway; GO:0010628 positive regulation of gene expression; GO:0019933 cAMP-mediated signaling; GO:0030073 insulin secretion; GO:0031175 neuron projection development; GO:0032879 regulation of localization; GO:0032880 regulation of protein localization; GO:0043547 positive regulation of GTPase activity; GO:0045786 negative regulation of cell cycle; GO:0045860 positive regulation of protein kinase activity; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0060124 positive regulation of growth hormone secretion; GO:0070374 positive regulation of ERK1 and ERK2 cascade; GO:0071651 positive regulation of chemokine (C-C motif) ligand 5 production; GO:0120162 positive regulation of cold-induced thermogenesis
  • GO CC:  GO:0005576 extracellular region; GO:0043005 neuron projection; GO:0043204 perikaryon

Sequence Information

  • Sequence:  HSDGIFTDSYSRYRKQMAVKKYLAAVL
  • Length:  27
  • Propeptide:  MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
  • Signal peptide:  MTMCSGARLALLVYGIIMHSSVYS
  • Modification:  T27 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  19-19V->G: Strongly reduced affinity for ADCYAP1R1.; 20-20V->G: Strongly reduced affinity for ADCYAP1R1.; 21-21V->G: Strongly reduced affinity for ADCYAP1R1.; 22-22V->G: Strongly reduced affinity for ADCYAP1R1.; 26-26V->G: Strongly reduced affinity for AD

Activity

  • Function:  PACAP-27 phosphorylates mitogen activated protein kinase and increases VEGF expression in lung cancer cells.
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  ADCYAP1R1
  • Target Unid:  P41586
  • IC50: IC50 = 9.6±2.4 nM ( PubMed ID: 18353507 )
  • EC50: 5.6±0.9nM
  • ED50: NA
  • kd: NA
  • Half life: 39±4 minutes; /2340 seconds ( PubMed ID: 18353507 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P18509-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001969_AF2.pdbhor001969_ESM.pdb

Physical Information

Mass: 361257 Formula: C142H223N39O40S
Absent amino acids: CENPW Common amino acids: AKSY
pI: 10.11 Basic residues: 6
Polar residues: 8 Hydrophobic residues: 9
Hydrophobicity: -41.48 Boman Index: -5278
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 75.93
Instability Index: 2397.04 Extinction Coefficient cystines: 4470
Absorbance 280nm: 171.92

Literature

  • PubMed ID:  12409225##18353507
  • Title:  PACAP-27 Tyrosine Phosphorylates Mitogen Activated Protein Kinase and Increases VEGF mRNAs in Human Lung Cancer Cells